How to use from the
Use from the
Transformers library
# Load model directly
from transformers import AutoTokenizer, AutoModelForSeq2SeqLM

tokenizer = AutoTokenizer.from_pretrained("Exscientia/IgT5")
model = AutoModelForSeq2SeqLM.from_pretrained("Exscientia/IgT5")
Quick Links

IgT5 model

Model pretrained on protein and antibody sequences using a masked language modeling (MLM) objective. It was introduced in the paper Large scale paired antibody language models.

The model is finetuned from IgT5-unpaired using paired antibody sequences from the Observed Antibody Space.

Use

The encoder part of the model and tokeniser can be loaded using the transformers library

from transformers import T5EncoderModel, T5Tokenizer

tokeniser = T5Tokenizer.from_pretrained("Exscientia/IgT5", do_lower_case=False)
model = T5EncoderModel.from_pretrained("Exscientia/IgT5")

The tokeniser is used to prepare batch inputs

# heavy chain sequences
sequences_heavy = [
    "VQLAQSGSELRKPGASVKVSCDTSGHSFTSNAIHWVRQAPGQGLEWMGWINTDTGTPTYAQGFTGRFVFSLDTSARTAYLQISSLKADDTAVFYCARERDYSDYFFDYWGQGTLVTVSS",
    "QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSS"
]

# light chain sequences
sequences_light = [
    "EVVMTQSPASLSVSPGERATLSCRARASLGISTDLAWYQQRPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDSAVYYCQQYSNWPLTFGGGTKVEIK",
    "ALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQSEDEADYYCNSLTSISTWVFGGGTKLTVL"
]

# The tokeniser expects input of the form ["V Q ... S S </s> E V ... I K", ...]
paired_sequences = []
for sequence_heavy, sequence_light in zip(sequences_heavy, sequences_light):
    paired_sequences.append(' '.join(sequence_heavy)+' </s> '+' '.join(sequence_light))

tokens = tokeniser.batch_encode_plus(
    paired_sequences, 
    add_special_tokens=True, 
    pad_to_max_length=True, 
    return_tensors="pt",
    return_special_tokens_mask=True
)

Note that the tokeniser adds a </s> token at the end of each paired sequence and pads using the <pad> token. For example a batch containing sequences V Q L </s> E V V, Q V </s> A L will be tokenised to V Q L </s> E V V </S> and Q V </s> A L </s> <pad> <pad>.

Sequence embeddings are generated by feeding tokens through the model

output = model(
    input_ids=tokens['input_ids'], 
    attention_mask=tokens['attention_mask']
)

residue_embeddings = output.last_hidden_state

To obtain a sequence representation, the residue tokens can be averaged over like so

import torch

# mask special tokens before summing over embeddings
residue_embeddings[tokens["special_tokens_mask"] == 1] = 0
sequence_embeddings_sum = residue_embeddings.sum(1)

# average embedding by dividing sum by sequence lengths
sequence_lengths = torch.sum(tokens["special_tokens_mask"] == 0, dim=1)
sequence_embeddings = sequence_embeddings_sum / sequence_lengths.unsqueeze(1)
Downloads last month
9,746
Safetensors
Model size
3B params
Tensor type
F32
·
Inference Providers NEW
This model isn't deployed by any Inference Provider. 🙋 Ask for provider support

Model tree for Exscientia/IgT5

Finetuned
(1)
this model

Paper for Exscientia/IgT5